Connecting...

Jobs in Systems Engineering

Found jobs
    • Brisbane, Australia
    • Boeing
    • Posted 1 day ago

    Description: About Boeing: Job Description At Boeing, we innovate and collaborate to make the world a better place. From the seabed to outer space, you can contribute to work that matters with a company where diversity, equity and inclusion are shared values. We're committed to fostering an environment for every teammate that's welcoming, respec...

    W1siziisijiwmtkvmdcvmduvmdevndqvmzyvote4l2jvzwluz19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • North Ryde, Australia
    • Ntt Australia
    • Posted 1 day ago

    At NTT we believe that by using innovative technology we can solve global challenges and create a world that is sustainable and secure. We are looking for curious people, from diverse backgrounds, that are keen to work in a fast-paced and agile environment. At NTT we trust our employees to do the right thing, even when no one is watching, which ...

    • Sydney, New South Wales, Australia
    • UGL
    • Posted 1 day ago

    About the role The role of the Systems Engineer is to provide specialist systems engineering support to T&T engineering design projects Develop the Systems Assurance related documentation, process guidelines to support the business. Define and monitor effective implementation of Reliability, Availability, Maintainability, and Safety (RAMS) proce...

    W1siziisijiwmtkvmtavmzevmdivmjivmzevmzezl1vhtc5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Sydney, New South Wales, Australia
    • UGL
    • Posted 1 day ago

    About the role The Asset Systems Engineer is responsible for working with the Business Support Applications like EMD, Insight, and others under the Business Application Manager/Lead - Engineering. Provide input and be responsible for the production of Project Documentation (Design Reports, Drawings, Programs, Quality Plans, Project Document Mana...

    W1siziisijiwmtkvmtavmzevmdivmjivmzevmzezl1vhtc5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Brisbane, Australia
    • Boeing
    • Posted 1 day ago

    Job Description At Boeing, we innovate and collaborate to make the world a better place. From the seabed to outer space, you can contribute to work that matters with a company where diversity, equity and inclusion are shared values. We're committed to fostering an environment for every teammate that's welcoming, respectful and inclusive, with gr...

    W1siziisijiwmtkvmdcvmduvmdevndqvmzyvote4l2jvzwluz19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Adelaide, Australia
    • Boeing
    • Posted 1 day ago

    Job Description At Boeing, we innovate and collaborate to make the world a better place. From the seabed to outer space, you can contribute to work that matters with a company where diversity, equity and inclusion are shared values. We're committed to fostering an environment for every teammate that's welcoming, respectful and inclusive, with gr...

    W1siziisijiwmtkvmdcvmduvmdevndqvmzyvote4l2jvzwluz19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Williamtown, Australia
    • Boeing
    • Posted 1 day ago

    Job Description At Boeing, we innovate and collaborate to make the world a better place. From the seabed to outer space, you can contribute to work that matters with a company where diversity, equity and inclusion are shared values. We're committed to fostering an environment for every teammate that's welcoming, respectful and inclusive, with gr...

    W1siziisijiwmtkvmdcvmduvmdevndqvmzyvote4l2jvzwluz19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Brisbane, Australia
    • Saab USA
    • Posted 1 day ago

    About us Saab Australia is a defence, security and cyber solutions provider, specialising in the development and integration of major defence and security systems. For over 30 years in Australia, we have built a reputation for delivering complex systems integration projects that provide proven and advanced capabilities to keep us ahead of today'...

    W1siziisijiwmjevmtavmtgvmdgvmdivmzevngezoduyntmtngq3ns00y2i5lwjhyjetnmziztdjmjc3yzq3l1nhywitbg9nby5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Perth, Australia
    • Hitachi
    • Posted 1 day ago

    Our Company Hitachi Vantara is part of the Global Hitachi Family. We balance innovation with an open, friendly culture and the backing of a long-established parent company, known for its ethical reputation. We guide customers from what is now to what is next by unlocking the value and changing the world with data and applications to solve digita...

    W1siziisijiwmjavmdgvmjavmdcvmjevndqvnjkwl0hpdgfjaglfr3jvdxbftg9nby5zdmcucg5nil0swyjwiiwidgh1bwiilciyntv4mtiwxhuwmdnlil1d
    • Mawson Lakes, Australia
    • Raytheon
    • Posted 1 day ago

    We're Hiring Systems Engineers. Multiple opportunities are now available at our new Centre for Joint Integration in Adelaide and at other Raytheon Australia locations nationwide. Secure one of the most exciting jobs in the country. Work on leading edge technology to deliver Australia's most significant defence capability programs. Are you ready ...

    W1siziisijiwmjavmdyvmdkvmtevmtmvmdqvmzywl1jhexrozw9uvgvjac5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Melbourne, Victoria, Australia
    • DXC Technology
    • Posted 1 day ago

    Job Description: Why join DXC Technology? DXC Technology (NYSE:DXC) - where brilliant people embrace change and seize opportunities to advance their careers and amplify customer success. People are the heart of our business. We support each other and work as a team, globally and locally to deliver excellence for our customers and colleagues. We ...

    W1siziisijiwmjevmdivmjuvmduvmtuvmdevzdgxogvingetote3ys00mzcxlwexntmtntgzmzlmzmqwowfkl2r4yy10zwnobm9sb2d5lnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Williamtown, Australia
    • Boeing
    • Posted 1 day ago

    Job Description At Boeing, we innovate and collaborate to make the world a better place. From the seabed to outer space, you can contribute to work that matters with a company where diversity, equity and inclusion are shared values. We're committed to fostering an environment for every teammate that's welcoming, respectful and inclusive, with gr...

    W1siziisijiwmtkvmdcvmduvmdevndqvmzyvote4l2jvzwluz19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • North Sydney, Australia
    • Downer Group
    • Posted 1 day ago

    Systems Engineer - IP Rail Systems Apply now Job ID: 581607 Job type: Full Time - Permanent Location: Canberra, Fyshwick, Sydney, North Sydney, Brisbane, Adelaide, Melbourne, Perth, North Ryde Categories: Engineering (All disciplines) Who we are Downer is the leading provider of integrated services in Australia and New Zealand. Through trusted r...

    W1siziisijiwmtkvmdyvmduvmtevmzcvmjavotayl0rvd25lcl9sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Macquarie Park, Australia
    • Raytheon
    • Posted 1 day ago

    Join a highly respected global company and world leader in innovation and technology; Offering challenging and rewarding opportunities in support of Australia's defence capability; Multiple locations: Sydney, Perth, Adelaide. At Raytheon Australia, we draw the brightest minds and give them work that excites them while continuously developing an ...

    W1siziisijiwmjavmdyvmdkvmtevmtmvmdqvmzywl1jhexrozw9uvgvjac5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Port Melbourne, Australia
    • Boeing
    • Posted 1 day ago

    Systems Engineer - Modelling and Simulation (MBE) Company: Boeing Aerostructures AUS PTY Job ID: 00000281285 Date Posted: 2021-10-21-07:00 Location: AUS - Port Melbourne, Australia Job Description Qualifications: At Boeing, we are all innovators on a mission to connect, protect, explore and inspire. From the sea bed to outer space, you'll learn ...

    W1siziisijiwmtkvmdcvmduvmdevndqvmzyvote4l2jvzwluz19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Macquarie Park, Australia
    • Raytheon
    • Posted 1 day ago

    Tailored career and development opportunities Position will be based at Raytheon's new facility in Mawson Lakes South Australia or Macquarie Park NSW. Full time employment An exciting opportunity is now available for a Systems Engineer to join Raytheon Australia's Combat Systems Technical Support Services team providing technical support to the ...

    W1siziisijiwmjavmdyvmdkvmtevmtmvmdqvmzywl1jhexrozw9uvgvjac5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Perth, Australia
    • Aurecon
    • Posted 1 day ago

    Just imagine your future with us... At Aurecon we see the future through a very different lens. Do you? Innovation, eminence and digital are at the heart of everything we do. Are you excited about the future? Are you driven by the opportunity to work on some of the most challenging and complex projects around the world and to learn from the best...

    W1siziisijiwmtkvmdyvmtmvmdivmzqvmdqvnde1l2f1cmvjb24ixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Macquarie Park, Australia
    • Raytheon
    • Posted 1 day ago

    Tailored career and development opportunities Position will be based at Raytheon's new facility in Mawson Lakes South Australia or Macquarie Park NSW. Full time employment An exciting opportunity is now available for a Senior Systems Engineer to join Raytheon Australia's Combat Systems Technical Support Services team providing technical support ...

    W1siziisijiwmjavmdyvmdkvmtevmtmvmdqvmzywl1jhexrozw9uvgvjac5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Brisbane, Australia
    • GHD
    • Posted 4 days ago

    GHD has global expertise in Power Systems Engineering with significant experience in complex power system modelling for renewable energy projects. Furthermore, we have partnered up with a number of international renewable energy clients in developing cutting edge origination solutions. With GHD's ever-increasing international focus on future ene...

    W1siziisijiwmtkvmdcvmduvmduvmdkvmtuvodm0l0dirc5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Australia
    • Thales
    • Posted 4 days ago

    We're inventing the future, right here, right now, at Thales. We design the critical security solutions of tomorrow by combining the curiosity to explore, the intelligence to question and the vision to create. Together we solve complicated problems by combining our experience in the market with our leading research and development capabilities. ...

    W1siziisijiwmtkvmdcvmdyvmdmvndyvmtavmtkyl1roywxlc19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Clayton, Victoria, Australia
    • Leidos
    • Posted 4 days ago

    Company Description At Leidos we bring together science, engineering and technology to deliver smart solutions to our customers' most complex challenges. Great ideas are our currency and every person here is encouraged and enabled to be curious, open-minded and confident in bringing theirs to the table - to be inspired by what they can achieve a...

    W1siziisijiwmjevmdivmjuvmduvmjmvmjyvnzy0ode3zwmtzjrlyi00mthmlwe2mmutzwe0mzuzmjvimta4l2xlawrvcy5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Adelaide, Australia
    • Boeing
    • Posted 4 days ago

    Description: About Boeing: Job Description At Boeing, we innovate and collaborate to make the world a better place. From the seabed to outer space, you can contribute to work that matters with a company where diversity, equity and inclusion are shared values. We're committed to fostering an environment for every teammate that's welcoming, respec...

    W1siziisijiwmtkvmdcvmduvmdevndqvmzyvote4l2jvzwluz19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Melbourne, Australia
    • Thales
    • Posted 4 days ago

    We're inventing the future, right here, right now, at Thales. We design the critical security solutions of tomorrow by combining the curiosity to explore, the intelligence to question and the vision to create. Together we solve complicated problems by combining our experience in the market with our leading research and development capabilities. ...

    W1siziisijiwmtkvmdcvmdyvmdmvndyvmtavmtkyl1roywxlc19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Melbourne, Victoria, Australia
    • Leidos
    • Posted 4 days ago

    Company Description Introductions The first thing you learn at Leidos Australia is to leave current thinking at the door. Our aim is to make the world a safer, healthier and more efficient place, but we won't get far using existing ideas. Due to our ongoing success, the Leidos family is growing rapidly across Melbourne and Canberra. This year is...

    W1siziisijiwmjevmdivmjuvmduvmjmvmjyvnzy0ode3zwmtzjrlyi00mthmlwe2mmutzwe0mzuzmjvimta4l2xlawrvcy5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Australia
    • Thales
    • Posted 4 days ago

    We're inventing the future, right here, right now, at Thales. We design the critical security solutions of tomorrow by combining the curiosity to explore, the intelligence to question and the vision to create. Together we solve complicated problems by combining our experience in the market with our leading research and development capabilities. ...

    W1siziisijiwmtkvmdcvmdyvmdmvndyvmtavmtkyl1roywxlc19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Canberra, Australian Capital Territory, Australia
    • Leidos
    • Posted 4 days ago

    Company Description About Us Every person at Leidos plays an important and valued role bringing science, engineering and technology together to produce practical solutions for our customers' most complex problems. It's how we help to make the world safer, healthier and more efficient - work that matters and a mission, like those of our customers...

    W1siziisijiwmjevmdivmjuvmduvmjmvmjyvnzy0ode3zwmtzjrlyi00mthmlwe2mmutzwe0mzuzmjvimta4l2xlawrvcy5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Adelaide, Australia
    • QinetiQ
    • Posted 4 days ago

    QinetiQ employs more than 6000 people in 51 locations around the world, offering our customers premier expertise in advice, services and creative technology-based products. QinetiQ Australia, part of the global QinetiQ group, provides technological and scientific expertise to help customers protect and advance their vital interests. As an innova...

    W1siziisijiwmjavmdgvmduvmdyvmdyvmzyvnzc1l1fpbmv0axffam9ic19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Australia
    • Thales
    • Posted 4 days ago

    We're inventing the future, right here, right now, at Thales. We design the critical security solutions of tomorrow by combining the curiosity to explore, the intelligence to question and the vision to create. Together we solve complicated problems by combining our experience in the market with our leading research and development capabilities. ...

    W1siziisijiwmtkvmdcvmdyvmdmvndyvmtavmtkyl1roywxlc19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Canberra, Australian Capital Territory, Australia
    • Leidos
    • Posted 4 days ago

    Company Description We bring together science, engineering and technology to deliver smart solutions to our Government customers' most complex problems - innovative, technically advanced and highly practical. For example, we deliver software applications for a wide range of missions in the Intelligence, Surveillance and Reconnaissance domain. We...

    W1siziisijiwmjevmdivmjuvmduvmjmvmjyvnzy0ode3zwmtzjrlyi00mthmlwe2mmutzwe0mzuzmjvimta4l2xlawrvcy5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Australia
    • Thales
    • Posted 4 days ago

    We're inventing the future, right here, right now, at Thales. We design the critical security solutions of tomorrow by combining the curiosity to explore, the intelligence to question and the vision to create. Together we solve complicated problems by combining our experience in the market with our leading research and development capabilities. ...

    W1siziisijiwmtkvmdcvmdyvmdmvndyvmtavmtkyl1roywxlc19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq

Get new jobs for this search by email

By submitting your details you agree to our T&C's