Connecting...

Jobs in Electrical/Electronic Engineering

Found jobs
    • Sydney
    • KBR
    • Posted 4 days ago

    Title: Electrical Engineer The Role KBR are currently seeking an experienced Electrical Engineer to join its team in the maritime domain. As our Electrical Engineer, you will be involved within a broad team and responsible for the provision of specialist engineering services related to electrical engineering and remediation of platform services ...

    W1siziisijiwmtkvmdcvmduvmtavntqvmjyvnzuzl0tcul9sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Dudley Park
    • $80,669 - $92,150 (plus super)
    • Department of Defence
    • Posted 5 days ago

    APS level 6 $80,669 - $92,150 (plus super) Dudley Park, SA The Role As an Electrical Engineer, Mechanical Engineer or a Naval Architect working in an integrated workforce you will support the Mission System team in prosecuting the engineering assurance plans to aid in assuring the FSP design as fit for purpose. Utilising proficiency in engineeri...

    W1siziisijiwmtkvmdyvmtivmdevndevmtyvnjiwlzuwmhb4lurlcgfydg1lbnrfb2zfrgvmzw5jzv8oqxvzdhjhbglhkv8tx0xvz28uc3znlmpwzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Nowra
    • Raytheon
    • Posted 8 days ago

    Career and development opportunities Fast paced and dynamic work environment Position will be based in Nowra, NSW At Raytheon, we draw the brightest minds and give them work that excites them while continuously developing an environment for learning to maintain a highly-skilled, world-class workforce. Raytheon Australia is currently looking for ...

    W1siziisijiwmjavmdyvmdkvmtevmtmvmdqvmzywl1jhexrozw9uvgvjac5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Melbourne
    • Fortive
    • Posted 12 days ago

    Invetech has been creating breakthrough products and custom automation systems for more than 30 years. With experience drawn from more than 5,000 projects globally, Invetech partners with global leaders in industry to deliver product design and development, contract manufacturing, and custom automation services. The company has experience in a b...

    W1siziisijiwmjavmdgvmdkvmdavndmvmzcvmjeyl0zvcnrpdmuucg5nil0swyjwiiwidgh1bwiilciyntv4mtiwxhuwmdnlil1d
    • Melbourne
    • Fortive
    • Posted 14 days ago

    We are global innovators, product realisation partners, creators of breakthrough products and custom automation systems. With over 30 years of experience within a range of healthcare market sectors we blend creativity, commercial know-how and technical acumen to help our clients create business success. This industry experience not only makes In...

    W1siziisijiwmjavmdgvmdkvmdavndmvmzcvmjeyl0zvcnrpdmuucg5nil0swyjwiiwidgh1bwiilciyntv4mtiwxhuwmdnlil1d
    • Darwin
    • Thales
    • Posted 14 days ago

    Thales people provide armed forces customers with operational advantage at every decisive moment throughout the mission. Defence and armed forces customers rely on us to deliver the full range of defence mission systems solutions at land, sea, and air. Our platforms extend across the battlespace including Above and Sonar, Electronic Combat, and ...

    W1siziisijiwmtkvmdcvmdyvmdmvndyvmtavmtkyl1roywxlc19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Claremont
    • Mondelez
    • Posted 16 days ago

    Mondelēz International. Make it with us. We take pride in making and baking the world's most iconic snacking brands, such as Cadbury, Oreo, Philadelphia, Pascall and The Natural Confectionery Company. From innovation and manufacturing, to marketing and selling, everything we do is brought to life by the brightest minds, collaboration and of cour...

    W1siziisijiwmjavmdgvmdkvmdyvntavndgvnzuvtw9uzgfszxoucg5nil0swyjwiiwidgh1bwiilciyntv4mtiwxhuwmdnlil1d
    • Sydney
    • LTK Engineering
    • Posted 17 days ago

    LTK ENGINEERING SERVICES, one of the nation's most respected consultants to the railroad and rail transit industries, is currently seeking to identify suitably qualified persons for the position listed below. RAIL VEHICLE ELECTRICAL AND ELECTRONIC SYSTEMS ENGINEER Sydney, Australia Minimum Qualifications: The ideal candidate has a Bachelor's deg...

    W1siziisijiwmjavmdgvmdgvmdavndyvntavmju4l0xus19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Melbourne
    • Quick Release
    • Posted 17 days ago

    About Quick Release Quick Release (as part of Alten Group) is a managed service provider that operates in the automotive, railway and defence industries with customers including Ford, Jaguar, Land Rover, BMW, Aston Martin, Rivian and Thales. With offices in Germany, the UK, North America and now Australia, QR provides innovative solutions to mul...

    • Alice Springs
    • Amentum
    • Posted 17 days ago

    Job Summary Sr. Electrical Engineer (Power Systems) Imagine working in Alice Springs Australia with a team of professionals providing mission critical support. What you'll be doing As a Sr. Electrical Engineer, you will be responsible for the oversight of the engineering design, procurement, construction and modification of installations associa...

    W1siziisijiwmjavmdgvmdkvmdcvmjkvmzqvnzawl2ftzw50dw0ucg5nil0swyjwiiwidgh1bwiilciyntv4mtiwxhuwmdnlil1d
    • Melbourne CBD
    • Jacobs
    • Posted 19 days ago

    Undergraduate Electrical Engineer (Rail Signalling) - (ANZ00015A) Description What if... ... we showed you how we're solving the world’s greatest challenges by transforming intangible ideas into intelligent solutions for a more connected, sustainable world? At Jacobs, we push the limits of what’s possible to make the world smarter and more acces...

    W1siziisijiwmjavmdyvmdgvmdyvmtavmjmvota2l1vudgl0bgvkltiucg5nil0swyjwiiwidgh1bwiilciyntv4mtiwxhuwmdnlil1d
    • Perth
    • Jacobs
    • Posted 19 days ago

    What if... ... we showed you how we're solving the world’s greatest challenges by transforming intangible ideas into intelligent solutions for a more connected, sustainable world? At Jacobs, we push the limits of what’s possible to make the world smarter and more accessible for all. In our transport work, that means designing innovative solution...

    W1siziisijiwmjavmdyvmdgvmdyvmtavmjmvota2l1vudgl0bgvkltiucg5nil0swyjwiiwidgh1bwiilciyntv4mtiwxhuwmdnlil1d
    • 20000 - 174000
    • Hill Robinson Asia Pacific
    • Posted 30 days ago

    The Opportunity: We are currently seeking candidates for multiple Engineering positions located at a large private estate located in the Middle East. We are searching for multiple candidates with qualifications in - AVIT, MEP, Technical as well as a Managing CTO position, which will oversee over 120 multi-national staff and contractors for this ...

Get new jobs for this search by email

By submitting your details you agree to our T&C's