Connecting...

Jobs in North West & Hills District

Found 17 jobs
    • Goulburn
    • $114,230 – $128,556
    • Leonard Holt Robb
    • Posted 7 days ago

    The Opportunity Forget about sitting in traffic for hours and paying for parking. It’s all about balance and in Goulburn, we believe in a great work/life balance. Just 2 hours from Sydney, less than 1 hour from Canberra and 1.5 hours to the coast, right now in Goulburn, your next career opportunity awaits with Goulburn Mulwaree Council. The Role...

    W1siziisijiwmtkvmtevmjuvmdavmdqvmtevndqyl0dnqybmb2dvlmpwzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Goulburn
    • 98,933 - 111,346
    • Leonard Holt Robb
    • Posted 14 days ago

    The Opportunity Forget about sitting in traffic for hours and paying for parking. It’s all about balance and in Goulburn, we believe in a great work/life balance. Just 2 hours from Sydney, less than 1 hour from Canberra and 1.5 hours to the coast, right now in Goulburn, your next career opportunity awaits with Goulburn Mulwaree Council. The Role...

    W1siziisijiwmtkvmtevmtcvmjmvndqvndmvnjc4l0dnqybmb2dvlmpwzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Edinburgh
    • $142,470 - $160,330 (plus super)
    • Department of Defence
    • Posted 19 days ago

    EL2 (S&T Level 7) $142,470 - $160,330 (plus super) Russell, ACT. Edinburgh, SA. Cyber and Electronic Warfare Division is seeking Group Leaders with a national or international reputation in the following Science and Technology (S&T) areas: Radio Frequency Electronic Warfare Electro-Optic Electronic Warfare Communications Electronic Warfare Wirel...

    W1siziisijiwmtkvmdyvmtivmdevndevmtyvnjiwlzuwmhb4lurlcgfydg1lbnrfb2zfrgvmzw5jzv8oqxvzdhjhbglhkv8tx0xvz28uc3znlmpwzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Canberra CBD
    • $142,470 - $160,330 (plus super)
    • Department of Defence
    • Posted 19 days ago

    EL2 (S&T Level 7) $142,470 - $160,330 (plus super) Russell, ACT. Edinburgh, SA. Cyber and Electronic Warfare Division is seeking Group Leaders with a national or international reputation in the following Science and Technology (S&T) areas: Radio Frequency Electronic Warfare Electro-Optic Electronic Warfare Communications Electronic Warfare Wirel...

    W1siziisijiwmtkvmdyvmtivmdevndevmtyvnjiwlzuwmhb4lurlcgfydg1lbnrfb2zfrgvmzw5jzv8oqxvzdhjhbglhkv8tx0xvz28uc3znlmpwzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Canberra
    • $118,376 - $142,087 (plus super)
    • Department of Defence
    • Posted 24 days ago

    Executive Level 2 $118,376 - $142,087 (plus super) Campbell Park, ACT The Naval Technical Bureau (NTB) is seeking an experienced Engineering Manager with a background in naval systems and technology to fill the position of Power Machinery and Armaments Domain Lead. Whilst leading and managing a team of engineers and technical specialists, you wi...

    W1siziisijiwmtkvmdyvmtivmdevndevmtyvnjiwlzuwmhb4lurlcgfydg1lbnrfb2zfrgvmzw5jzv8oqxvzdhjhbglhkv8tx0xvz28uc3znlmpwzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Brisbane
    • Boeing
    • Posted 26 days ago

    About us Boeing Defence Australia is shaping the future of aerospace and delivering some of the nation's most important programs for the Australian Defence Force. Joining us is a chance to make your mark, working with a diverse team that is united in pushing the boundaries of imagination and excellence. We currently employ more than 2,500 people...

    W1siziisijiwmtkvmdcvmduvmdevndqvmzyvote4l2jvzwluz19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Canberra
    • Boeing
    • Posted 26 days ago

    About us Boeing Defence Australia is shaping the future of aerospace and delivering some of the nation's most important programs for the Australian Defence Force. Joining us is a chance to make your mark, working with a diverse team that is united in pushing the boundaries of imagination and excellence. We currently employ more than 2,500 people...

    W1siziisijiwmtkvmdcvmduvmdevndqvmzyvote4l2jvzwluz19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Brisbane
    • Boeing
    • Posted 26 days ago

    About us Boeing Defence Australia is shaping the future of aerospace and delivering some of the nation's most important programs for the Australian Defence Force. Joining us is a chance to make your mark, working with a diverse team that is united in pushing the boundaries of imagination and excellence. We currently employ more than 2,500 people...

    W1siziisijiwmtkvmdcvmduvmdevndqvmzyvote4l2jvzwluz19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Cairns
    • Aurecon
    • Posted 26 days ago

    Just imagine your future with us…At Aurecon we see the future through a very different lens. Do you? Innovation, eminence and digital are at the heart of everything we do. Are you excited about the future? Are you driven by the opportunity to work on some of the most challenging and complex projects around the world and to learn from the best? W...

    W1siziisijiwmtkvmdyvmtmvmdivmzqvmdqvnde1l2f1cmvjb24ixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Perth CBD
    • Aurecon
    • Posted 26 days ago

    Just imagine your future with us… At Aurecon we see the future through a very different lens. Do you? Innovation, eminence and digital are at the heart of everything we do. Are you excited about the future? Are you driven by the opportunity to work on some of the most challenging and complex projects around the world and to learn from the best? ...

    W1siziisijiwmtkvmdyvmtmvmdivmzqvmdqvnde1l2f1cmvjb24ixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0
    • Melbourne
    • Thales
    • Posted 26 days ago

    About Thales Thales people architect solutions that are relied upon to deliver operational advantage at every decisive moment throughout the mission. Defence and armed forces customers rely on us to deliver the full range of defensive systems for land, sea, and air. From early warning, to threat neutralisation, our platforms cover all levels fro...

    W1siziisijiwmtkvmdcvmdyvmdmvndyvmtavmtkyl1roywxlc19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Melbourne
    • Thales
    • Posted 26 days ago

    About Thales Thales people architect solutions that are relied upon to deliver operational advantage at every decisive moment throughout the mission. Defence and armed forces customers rely on us to deliver the full range of defensive systems for land, sea, and air. From early warning, to threat neutralisation, our platforms cover all levels fro...

    W1siziisijiwmtkvmdcvmdyvmdmvndyvmtavmtkyl1roywxlc19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Melbourne
    • Thales
    • Posted 26 days ago

    About Thales Thales people architect solutions that are relied upon to deliver operational advantage at every decisive moment throughout the mission. Defence and armed forces customers rely on us to deliver the full range of defensive systems for land, sea, and air. From early warning, to threat neutralisation, our platforms cover all levels fro...

    W1siziisijiwmtkvmdcvmdyvmdmvndyvmtavmtkyl1roywxlc19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Brisbane
    • Rheinmetall Defence Australia
    • Posted 26 days ago

    Creative Autonomy WHY YOU SHOULD JOIN US Are you looking for a new position that gives you the freedom to mould your future however you like? Then you will find the Rheinmetall Group to be an attractive employer. When you work for us, you have more than a job. With your skills and ideas, you have the opportunity to make an impact. SOLUTIONS FOR ...

    W1siziisijiwmtkvmdgvmjivmdevmtivmjivodu2l1jozwlubwv0ywxslnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Sydney
    • AECOM
    • Posted 27 days ago

    In this position, you will have the opportunity to work on a range of large exciting projects and stakeholders providing you with an opportunity to apply your experience in a global company. AECOM is currently working on a range of exciting project which includes light rail, metro, passenger rail, freight and higher speed rail. You will work eff...

    W1siziisijiwmtkvmdyvmtivmdavntavntuvodu3l0ffq09nx0xpr08ucg5nil0swyjwiiwidgh1bwiilciyntv4mtiwxhuwmdnlil1d
    • Brisbane
    • Boeing
    • Posted 29 days ago

    About us Boeing Defence Australia is shaping the future of aerospace and delivering some of the nation's most important programs for the Australian Defence Force. Joining us is a chance to make your mark, working with a diverse team that is united in pushing the boundaries of imagination and excellence. We currently employ more than 2,500 people...

    W1siziisijiwmtkvmdcvmduvmdevndqvmzyvote4l2jvzwluz19sb2dvlnbuzyjdlfsiccisinrodw1iiiwimju1edeymfx1mdazzsjdxq
    • Perth CBD
    • UGL
    • Posted 30 days ago

    With recent project wins and a pipeline of work we are keen for you to join our National Signalling Team We are building centres of design excellence across all Australia’s major cities. Thrive in an inclusive and diverse environment that fosters flexible working. We can offer part-time and job share arrangements and the opportunity to work on c...

    W1siziisijiwmtkvmtavmzevmdivmjivmzevmzezl1vhtc5wbmcixsxbinailcj0ahvtyiisiji1nxgxmjbcdtawm2uixv0